PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc040735.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 118aa    MW: 12586.9 Da    PI: 5.8316
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc040735.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR134.56.8e-1162110252
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkteker 52 
                              fY++YA +vGF+ r+s+++k ++ g ++ ++ vCs+eg++++++++ +++ 
  Itr_sc040735.1_g00001.1  62 FYKQYAGSVGFDCRQSTTRKGRDGG-VVLKQAVCSREGFKKSSSST-SSTT 110
                              9***************999985555.889999*********99988.3333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.5E-862110IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
LNMDYASGGC DEGYSTDIGV EGNACDIEIS PGMTKYWRLN CAESLKPHVG QQFVSLDTAF  60
GFYKQYAGSV GFDCRQSTTR KGRDGGVVLK QAVCSREGFK KSSSSTSSTT QSNVGDVG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-09FAR1 family protein